Loading...
Statistics
Advertisement

rvv.xyz
www.rvv.xyz/

Rvv.xyz

Advertisement
Rvv.xyz is hosted in China / Beijing . Rvv.xyz doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_547_1608221.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by Rvv.xyz

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_547_1608221.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

CDN

Number of occurences: 1
  • CloudFront

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Rvv.xyz

Missing HTTPS protocol.

    Meta - Rvv.xyz

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 124.16.31.156
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • parkmydomain.vhostgo.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Wed, 14 Sep 2016 17:56:42 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=57r712ikujo0jo44vfnv4golt3; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_wx1123 Transfer-Encoding: chunked Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

    DNS

    host: parkmydomain.vhostgo.com
    1. class: IN
    2. ttl: 1697
    3. type: A
    4. ip: 124.16.31.156
    host: rvv.xyz
    1. class: IN
    2. ttl: 900
    3. type: CNAME
    4. target: parkmydomain.vhostgo.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.vv.xyz, www.rivv.xyz, www.ivv.xyz, www.rovv.xyz, www.ovv.xyz, www.rlvv.xyz, www.lvv.xyz, www.rlvv.xyz, www.lvv.xyz, www.r.vv.xyz, www..vv.xyz, www.rv.xyz, www.rvyv.xyz, www.ryv.xyz, www.rvzv.xyz, www.rzv.xyz, www.rvhv.xyz, www.rhv.xyz, www.rvnv.xyz, www.rnv.xyz, www.rvmv.xyz, www.rmv.xyz, www.rvjv.xyz, www.rjv.xyz, www.rvkv.xyz, www.rkv.xyz, www.rviv.xyz, www.riv.xyz, www.rv.xyz, www.rvvy.xyz, www.rvy.xyz, www.rvvz.xyz, www.rvz.xyz, www.rvvh.xyz, www.rvh.xyz, www.rvvn.xyz, www.rvn.xyz, www.rvvm.xyz, www.rvm.xyz, www.rvvj.xyz, www.rvj.xyz, www.rvvk.xyz, www.rvk.xyz, www.rvvi.xyz, www.rvi.xyz,

    Other websites we recently analyzed

    1. BMW Motorrad International Tourguide Academy
      Germany - 217.160.231.166
      Server software: Apache
      Technology: Html
      Number of meta tags: 3
    2. Fed Up! Our Fight to Save America from Washington, by Rick Perry | Fed Up!
      Scottsdale (United States) - 72.167.0.128
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like button, Twitter Button
      Number of Javascript: 5
      Number of meta tags: 1
    3. Ü­ºÃ±Â½Âº ±â°£ ¸¸·á¾È³»
      Korea, Republic of - 112.175.246.91
      Server software: nginx
      Technology: CSS, Html
    4. 4-jahreszeiten.info
      Germany - 213.95.81.32
      Server software: nginx
      Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Iframe, Javascript
      Number of Javascript: 10
      Number of meta tags: 8
    5. IMMOBILIARE ITALIA - Vendita e affitto immobili, agenzia immobiliare a Roma e Macerata
      Immobiliare Italia è un'agenzia di Macerata e Roma di vendita ed affitto di immobili, case vacanze, appartamenti, locali ed aree commerciali.
      Rome (Italy) - 185.81.0.40
      G Analytics ID: UA-68602926-1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery Validate, Php, Google Analytics, Joomla, Facebook Box
      Number of Javascript: 40
      Number of meta tags: 6
    6. barbot.org
      France - 188.165.245.24
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    7. The Indian Idiot
      The Indian Idiot provides you with trending & funny articles and reviews on Lifestyle, Technology, Bollywood, Pop culture, Desi Entertainment from India.
      Houston (United States) - 108.167.180.12
      G Analytics ID: UA-81116452-1
      Server software: nginx/1.10.1
      Technology: CSS, Flexslider, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, SVG, Google Analytics, WordPress Stats, Wordpress, Facebook Box
      Number of Javascript: 12
      Number of meta tags: 14
    8. Touisset Golf Course
      Scottsdale (United States) - 68.178.254.120
      Server software: Apache
      Technology: PayPal, CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    9. Главная
      Главная
      Amsterdam (Netherlands) - 5.79.84.48
      G Analytics ID: UA-25457449-1
      Server software: nginx
      Technology: CSS, Html, Javascript, Google Analytics, Add This, Facebook Box, Google +1 Button
      Number of Javascript: 4
      Number of meta tags: 4
    10. nimeshpatelkatyfamilyphysicians.com
      Wayne (United States) - 74.208.62.82
      Server software: Apache
      Technology: Html
      Number of meta tags: 1

    Check Other Websites